PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000894.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 540aa    MW: 60565.2 Da    PI: 4.5099
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000894.1_g00009.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.21.4e-52131401128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeelv +yLk+k+ ++++ + +vi e+d+yk++P dLp  +k+k+++++w+fFs+rd+ky+++ r+nratk+gyWk
  Itr_sc000894.1_g00009.1  13 LPPGFRFHPTDEELVLYYLKRKICRRRILT-DVIGETDVYKWDPDDLPelSKLKTGDRQWFFFSPRDRKYPNSGRTNRATKHGYWK 97 
                              79*************************988.99**************95449999******************************* PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd+++++ ++++vg+kktLvfykgrap+ge+tdWvmhey++
  Itr_sc000894.1_g00009.1  98 ATGKDRTITC-NSRDVGVKKTLVFYKGRAPTGERTDWVMHEYTM 140
                              **********.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.22E-596163IPR003441NAC domain
PROSITE profilePS5100555.76813163IPR003441NAC domain
PfamPF023654.2E-2814139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MVMAKEGLPD QRLPPGFRFH PTDEELVLYY LKRKICRRRI LTDVIGETDV YKWDPDDLPE  60
LSKLKTGDRQ WFFFSPRDRK YPNSGRTNRA TKHGYWKATG KDRTITCNSR DVGVKKTLVF  120
YKGRAPTGER TDWVMHEYTM DEMELSRCQS AQDYYALYKV FKKSGPGPKN GEQYGAPFNE  180
EDWADDECVG TNLHVEQEKS GKNVNDVGLI DDPKPNDVLP APIDGLEEFL KHIADEPSLT  240
ELLPIDNSYV DKLVGNEDTA NVLLDHSAGE VYLPVQTATL FSVPPLHNEQ ANFDLIHSET  300
LQPQLHEATE VTSAPVSERN PKVVEEDFLE DFLEMNDLDG PELSVNQNFD KPVENLGSQQ  360
FVDFDGLNEF ELYQDAAMFL HDMGAIGVGQ GAEQAANHLA NGIINPLSTD FGDQMVNNQQ  420
SYLNEGNEFN HQLWSHDLRC STVNPTEASQ NANLPLTSGV VYGNHLENHP VGANLNQNNI  480
QDDATNSSFS SALWAFMESI PATPASAAES VLVNKAFERM SSFRRLRLNA RNVKVASGAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-481314015140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613291.10.0PREDICTED: uncharacterized protein LOC104106448 isoform X1
TrEMBLQ8LRL80.0Q8LRL8_PETHY; Nam-like protein 7
STRINGSolyc04g072220.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32122451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-126NAC domain containing protein 17